<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16310 CA38772 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 48
2 3TC+D4T+IDV 178
3 3TC+D4T+EFV 126
4 D4T+DDI+NFV 40

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I   T12N, L63P, V77I, Q92E, I93L  
>CA38772| codons 1-99
PQITLWQRPLVNIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTELGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N P225H E6D, V35T, I135IT, S162A, V179VI, I244V, K277R, Q278H, T286A, P294T  
>CA38773| codons 1-300
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPVVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLRGAKALTEVITLTEEAE

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009