<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16276 CA38705 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 121
2 AZT+ 3TC 69
3 D4T+ NFV+ NVP 82
4 DDI+ RTV+ SQV 47
5 APV+ RTV+ ABC+ D4T+ DDI 148

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219KR     V35I, T39A, E40F, K43E, V60VI, A98S, V118I, K122E, I135T, I142V, R211K, I293V  
>CA38705| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAFLEEEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I84V, L90M L10F, L33F, N88D I13V, I15IV, K45R, L63P, V77VI, P79PH, I93L  
>CA38704| codons 1-99
PQITLWQRPFVTVKVGGQLKEALLDTGADNTVFEEMNLPGRWKPRMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGHTPVNVIGRDLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005