<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3933 CA38697 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV+NVP+RTV 118
2 3TC+AZT+EFV+IDV+RTV 24
3 D4T+IDV+LPV 35
4 AZT+IDV+LPV 39
5 IDV+LPV+TDF 44
6 3TC+NFV+T20+TDF 22
7 3TC+NFV+NVP+T20+TDF 33

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74IV, M184V, L210W, T215Y   L100I, K103N   P4S, T7A, K20R, V35I, K102R, E203K, Q207E, H208Y, R211K, A272G, E297K  
>CA38697| codons 1-299
PISSIEAVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYGGIKVKQLCKLLRGTKALTEVIPLTKEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I84V, L90M G73S L10I, E35D, M36I, L63P, I64V, A71V  
>CA38696| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTILEDINLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005