<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16262 CA38675 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 91
2 D4T 31
3 3TC+D4T 65
4 3TC+D4T+NFV 109
5 ABC+D4T+NFV 57
6 3TC+ABC+AZT+NFV 136

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67HN, K70R, L74I, M184V, L210W, T215F K219Q   A98G V8VI, K20R, T39TAEK, V60I, T69N, K122E, I135T, S162SN, K166R, G196E, H208Y, R211K, D218E, A288S, I293V, I329V, G333E, R356K, A371V, K390R, E399D, K454R, V466T, V467I, H483Y, E492D, S519N, Q547R, A554T  
>CA38675| codons 1-560
PISPIETIPVKLKPGMDGPRVKQWPLTEEKIKALVEICKELEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQYLWKWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQEQGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEVVQKIATESIVIWGKTPKFRLPIQKETWDAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGRAGYVTDRGRQKTISLTDTTNQKTELQ
AIYLALQDSGLDVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNERVDKLVSTGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I13V, K14KR, E35D, M36V, N37S, K45Q, L63P, I64V, V77I  
>CA38674| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADNTVLEDVSLPGRWKPQMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009