<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1445 CA3860 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 8
2 3TC+D4T+IDV 45

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML L10F I13V, K20T, N37S, I64V, I93L V11VG
>CA3860| codons 1-99
PQITLWQRPFVTVKIGGQLTEALLDTGADDTVLEEMSLPGRWKPKLIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219E     K11KR, K43Q, V60I, V118I, I135V, K166R, R211K, V245T L234LR
>CA3859| codons 1-254
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDEKHQKEPPFLWMGYERHPDKWT
VQPITLPEKDSWTV

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Rhee, SY Predictive Value of HIV-1 Genotypic Resistance Test Interpretation Algorithms. J Infect Dis, 2009