<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16211 CA38565 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 44
2 D4T+DDI+NVP 221

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215TFIS   Y181C   I5V, V35T, E40D, R83RK, V90VI, D123E, S163T, T165L, R211K  
>CA38565| codons 1-299
PISPVETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSTMLKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFSTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F L19E, I64V, H69Y  
>CA38564| codons 1-99
PQITLWQRPFVTIKIGGQEKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005