<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NMC-2716 NMC-2716 India 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36L, N37S, P39PS, R41K, L63P, H69K, L89M, I93L  
>NMC-2716| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEELSLSGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, S48T, D121Y, K122E, S162A, K173A, D177E, T200A, E204EK, Q207E, R211G, V245Q  
>NMC-2716| codons 1-256
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEKLREHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVND

References
Author Title Citation
Karade, S Limited HIV pretreatment drug resistance among adults attending free antiretroviral therapy clinic of Pune, India. ARHR, 2016