<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UA24 UA24 Indonesia 2013 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, M36I, R41K, H69K, L89I  
>UA24| codons 4-96
TLWQRPLVTVKIGGQLKEALLDTGADDTVFEEINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNILTQIGCT

References
Author Title Citation
Kotaki, T HIV-1 transmitted drug resistance mutations among antiretroviral therapy-naive individuals in Surabaya, Indonesia AIDS Res Ther, 2015