<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB086 LB086 Cameroon 2010 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E21X, E35N, M36I, N37D, R41K, L63P, C67Y, H69K, V77I, L89M  
>LB086| codons 15-99
IGGQLKXALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVRQYDQIPIEIYGKKAIGT
VLIGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Agyingi, L The evolution of HIV-1 group M genetic variability in Southern Cameroon is characterized by several emerging recombinant forms of CRF02_AG and viruses with drug resistance mutations. J Med Virol, 2014