<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
9RJ110339 9RJ110339 Brazil 2011 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, N37A, P39Q, Q61N, L63CS, H69HY, I72T, V77I, L89M  
>9RJ110339| codons 4-99
TLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMALQGRWKPKMIGGIGGFIKVRQYDNIS
IEICGYKATGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101E   T39K, K49R, V106I, I135A, S162C, E169D, K173A, Q174K, D177E, R211K, V245Q L100L*
>9RJ110339| codons 38-247
CKEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AG*EKKKSITVLDVGDAYFSVPLDKDFRKYTAFTIPSANNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRAKNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
de Lourdes Teixeira, M High rates of baseline antiretroviral resistance among HIV-infected pregnant women in an HIV referral centre in Rio de Janeiro, Brazil. Int J STD AIDS, 2015