<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1441 CA3851 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 122
2 AZT+DDI 104
3 3TC+AZT+DDI 61
4 AZT+DDI+RTV 26
5 AZT+DDI+IDV+NVP 76

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q K101E, Y181C, G190A   K20R, V35M, T39E, R83K, K104N, I202V, L228H  
>CA3851| codons 1-237
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICEEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLEKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKVEELRQHLLRWGFFTPDQKHQKEPPFHWMGYELHPD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M Q58E L10I, I15V, K20R, E35D, M36I, N37E, W42Y, K55R, R57K, I62V, L63P, A71V  
>CA3852| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDIELPGRYKPKLIGGIGGFVRVKEYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005