<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1440 CA3849 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC|APV|AZT|DDI|IDV|NFV|RTV|SQV NA
2 3TC+AZT+DDI+DLV+IDV+NFV 8
3 DDI+IDV+RTV+SQV 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, M184V, L210W, T215Y K219Q K103N V108I V35M, T39A, K43E, E44D, V60I, A98S, K122E, D177G, Q197E, T200A, E203K, Q207D, H208Y, R211K, D218E, L228H, A272P  
>CA3849| codons 1-279
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEEDGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYVDDLYVGSDLEIGEHRAKIKELRDYLWKWGFYTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A, L90M L33F, F53FL L10I, I13V, E35D, M36I, N37Q, R41K, I62V, L63C, I64V, A71T, T74TS, V77I, I93L  
>CA3850| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEDIQLPGKWKPKMIVGIGGLTKVRQYD
QVCVEICGHKTIGSVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001