<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16175 CA38488 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 74
2 D4T 35
3 3TC+AZT 22
4 3TC+DDI+IDV 61
5 D4T+NVP+RTV+SQV 265
6 None 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46ML, V82VA L10LF L63Q, I64V, A71AV, V77I  
>CA38488| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTILEEMNLPGRWKPKLIGGIGGFIKVRQYD
QIQVEICGHKVIGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, K70RS, Q151M, M184V A62AV, V75I, F77FL, F116Y     K49R, S68G, K122KE, D177G, T200TA, F214L, R284K, T286A, I293V, E297A  
>CA38489| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FVIKRKDGTSWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTEVVPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005