<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16163 CA38464 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+AZT+RTV+SQV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54ST, V82A L33LF, Q58E L10I, I13IV, K14KR, I15V, K20KR, E35D, M36I, N37D, D60E, Q61E, L63P, A71V, I93L  
>CA38464| codons 1-99
PQITLWQRPIVTVRVGGQLREALLDTGADDTVFEDIDLPGRWKPKMIVGIGGFTKVREYE
EIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35R, T39TA, A98S, I135T, D177E, I178ILM, T200TA, E204A, R211Q, F214L, E248D, V261VI, A272P, K281R, L283I, T286A, I293V, P313S, V317A, Q334L, M357T, G359S, K390R, A400T, V435A, E449D, L452A, T477A, H483N, K512T, V531I, Q547R, A554S I257IM
>CA38465| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEALRQHLLQWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDMQKLIGKLNWASQIYPGIKVKQLCRLIRGAKALTEVVPLTEEAE
LELAENREILKESVHGAYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARTRSA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRDTKAGKAGYVTDRGRQKVVSLTDTTNQKAELQ
AINLALQDSGLEVNIVTDSQYALGIIQAQPDTSESELVSQIIEQLIKKEKIYLAWVPAHK
GIGGNERVDKLVSSGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005