<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16156 CA38451 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 22
2 AZT+DDC 26
3 D4T 74
4 3TC+D4T+IDV 309
5 3TC+ABC+NVP 42

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V K219Q Y181C V108VI, V179VD K32N, V35I, T69N, K101R, K103KR, I135K, G196E, L228H, V245I, K249R, S251H, K277R, A288T, V292I, I293V, E297K  
>CA38451| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLRKRKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIDI
CQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIILPERDHWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKTLTEIVPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37E  
>CA38450| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMELPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009