<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4042 CA38425 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 104
2 D4T 104
3 3TC+ AZT+ RTV+ SQV 52
4 3TC+ AZT+ EFV+ RTV+ SQV 52
5 3TC+ D4T+ IDV+ NVP 62
6 3TC+ ABC+ APV+ AZT 41
7 3TC+ AZT+ IDV+ RTV 52
8 3TC+ DLV+ T20+ TDF 117

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L74LV, L210W, T215Y K219KNRS Y188YFHL, P236PL K101H, K238KT T27S, E28EA, K43E, E44EA, K49KR, V118I, K122E, I142IV, S162C, E169D, I178L, H208HY, R211K, L228H, A272P  
>CA38425| codons 1-274
PISPIETVPVKLKPGMDGPKVKQWPLSAEKIKALVEICTELEEAGKISRIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDLVI
YQYMDDLLVGSDLEIGQHRTKIEELRQYLWKWGFYTPDSKHQKEPPFHWMGYELHLDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, I62V, L63P, V77I, I93L  
>CA38424| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012