<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
08RJ060674 08RJ060674 Brazil 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M G73T L10I, T12K, I13M, I15V, L19I, K20V, L24F, E34T, M36I, N37ND, K43S, K55R, R57RK, I62V, L63P, A71V, I72L  
>08RJ060674| codons 1-99
PQITLWQRPIVKMKVGGQIVEALFDTGADDTVLTEIDLPGRWSPKIIGGIGGFVRVKQYD
QVPIEICGHKVLTTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V, T215Y A62V, K70T, V75I, F77L, F116Y K103N, Y188L   K49R, S68G, K122E, I135T, T200A, I202V, Q207E, V245R, A272P, L283I, I293V, I329V, K331N, Q332R  
>08RJ060674| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FVIKKKDGTTWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGQHRAKVEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIRLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQNRGQG

References
Author Title Citation
Waleria-Aleixo, A Drug resistance mutation profile and accumulation kinetics in human immunodeficiency virus-positive individuals infected with subtypes B and F failing highly active antiretroviral therapy are influenced by different viral codon usage patterns. AAC, 2008