<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1435 CA3837 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 20
2 AZT+D4T 29
3 3TC+D4T 12
4 3TC+AZT+D4T+IDV 28
5 DDC+RTV+SQV 29
6 AZT+DDI+NFV 28
7 ABC+EFV+RTV+SQV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M L23I, F53L L10V, T12S, L19Q, M36L, N37S, I62V, L63P, A71V  
>CA3837| codons 1-99
PQITLWQRPVVSIKIGGQQKEAILDTGADDTILEELSLPGRWKPKIIGGIGGLIKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74V, T215F K219Q Y181C, G190RS   V35K, V60I, K104N, V118I, K122E, I135T, S162D, F214L, A272P, Q278X L283IV
>CA3836| codons 1-296
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIVI
CQYMDDLYVSSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKXLCKLVRGTKALTEVIPLT

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009