<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16104 CA38335 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 117
2 3TC+ABC+DDC 78
3 D4T+DLV+NFV+SQV 39
4 D4T+DLV+IDV+NFV 31
5 D4T+DLV+LPV 143
6 ABC+AZT+DLV 39
7 ABC+DLV+TDF 49

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y K219KN K103N   E44D, A98S, D123E, D177E, I178M, H208Y, L210F, R211K, L228H, Q242H, A272P, I293V  
>CA38335| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLFKWGFYTPDNKHQKEPPFHWMGYELHPDKWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37S, I62V, L63P, I64V  
>CA38334| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009