<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16103 CA38333 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 35
2 ABC+D4T+NVP 70
3 3TC+ABC+D4T+NVP 5
4 3TC+ABC+NVP 102

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V A62V, V75I, F77L, F116Y, K219E K103N, Y181I E138EAKT S68G, T69N, K122E, I142IM, S162C, R211A, F214L, A272P V179N
>CA38333| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDGNKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSINNTTPGMRYQYNVLPMGWKGSPAIFQCSMTKILEPFRKQNPDINI
IQYVDDLYVGSDLEIGQHRTKIEELRQHLLAWGLTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13IV, K14KR, L63A, A71T, I72T, I93L  
>CA38332| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIAIEICGHKTTGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005