<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16095 CA38313 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+DDI 225

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75M, M184V, L210W, T215Y F77L, K219Q, N348I     E44D, V60I, V118I, K122E, D123N, I135M, K166R, R211RK, D218E, L228H, K277R, V292I, I293V, E297A, A327T, Q330R, Q332L, Q334G, G335S, Q336QR, A360T, K366R, A371V, A376T, A400T, D460N, R461K, S468T, T470N, L491S, L517I, Q524E, A554S, K558R I329M
>CA38313| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLITEMRKLGGSRWTYQIYQEPFKILKTGKYARMRGT
HTNDVRQLTEVVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVTLNDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESEIVSQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, R41K, I64V  
>CA38312| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005