<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5275 CA38308 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 57
2 D4T+DDI+NFV 61
3 3TC+D4T+IDV+RTV 159

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82T   K20R, E35D, M36I, N37D, K45KR, I62V, L63R, I64V, K70E, T74S, Q92K  
>CA38308| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPRMIGGIGGFIKVRQYD
QVRVEICGHEAIGSVLVGPTPTNIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y       K20R, V35IM, R83K, K122E, I135T, D177E, I178L, Q207E, R211K, V245K, A272P, R284K, T286A, E297K  
>CA38309| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVIPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005