<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1432 CA3830 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 208
2 3TC+AZT+IDV 161
3 D4T+DDI+SQV 7

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67NT, K70R, M184V, L210W, T215Y K219E     K20R, I31IL, V35I, T39A, V60I, K64KR, K122E, S134SR, I135T, Q174K, Q207E, R211K, L228H  
>CA3830| codons 1-278
PISPIETVPVKLKPGMDGPRVKQWPLTEEKLKALIEICAELEKEGKISKIGPENPYNTPI
FAIRKKTSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPRTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82T, L90M   L10I, T12P, K14R, Q61E, L63P, C67S, A71T, V77I, I93L, C95F  
>CA3831| codons 1-99
PQITLWQRPIVPIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
EIPIEISGHKTIGTVLIGPTPTNIIGRNLMTQLGFTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005