<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES163 RES163 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V, L90M L10F, N88D I15V, K20T, E35D, M36I, R41K, K45I, Q61R, I62V, L63P, I72V, I85V, I93L  
>RES163| codons 1-99
PQITLWQRPFVTIKVGGQLTEALLDTGADNTVLEDINLPGKWKPIMIGGIGGFVKVRQYD
RVPIEICGHKAVGTVLVGPTPVNIVGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     V35A, T39A, K49R, K122P, D123E, I135T, S162C, K173T, Q174K, D177E, Q197K, T200A, Q207E I63IL
>RES163| codons 1-262
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALAEICAEMEKEGKISRIGPENPYNTPV
FALKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGKHRAKIEELREHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVG

References
Author Title Citation
Waleria-Aleixo, A Drug resistance mutation profile and accumulation kinetics in human immunodeficiency virus-positive individuals infected with subtypes B and F failing highly active antiretroviral therapy are influenced by different viral codon usage patterns. AAC, 2008