<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1431 CA3829 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 182
2 3TC+AZT+SQV 57
3 D4T+NFV+NVP 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M L10F, I84L E35D, M36V, N37E, I62V, L63P, I64L  
>CA3829| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEDVELPGRWKPKLIGGIGGFIKVRQYD
QVPLEICGHKAIGTVLVGPTPVNLIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K103KN, Y181YC, G190GA   K43E, V118I, I135V, I142V, K166R, R211K, H221HY, L228LI, V245M  
>CA3828| codons 1-267
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTPDKKYQKEPPFIWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWA

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009