<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1430 CA3827 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 65
2 DDI 121
3 D4T 95
4 3TC+D4T+SQV 30
5 3TC+D4T+NVP+SQV 8
6 3TC+D4T+NFV 54

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   T31TP, E35D, M36I, M46X, I62V, L63H  
>CA3827| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNPVLEDINLPGRWKPKXIGGIGGFIKVRQYD
QVHIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L       R83K  
>CA3826| codons 1-124
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005