<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14505 CA38265 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+DDI+EFV 44

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184I   L100I, K103N   T69N, V90VI, D121H, K122E, S162C, T200A, E224D, L228R, A272P, K277R, I293V, E297EK, I329V, Q334E, G359S, K390R, A400T, V435I, S468P, T470A, L491S, Q547K, I556V, K558R  
>CA38265| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEIQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYIDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKDPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGEGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLADTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEKVDKLVSAGVRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, K20M, E35D, M36I, I64V  
>CA38264| codons 1-99
PQITLWQRPLVTIKVGGQIMEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012