<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14498 CA38258 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 22
2 3TC+AZT 39
3 3TC+AZT+SQV 9
4 3TC+AZT+IDV 135
5 3TC+AZT 109
6 None 113
7 3TC+ABC+AZT+NVP+TDF 9
8 3TC+DDI+IDV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F D60E  
>CA38258| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184IV   Y181I   V35I, I135IM, K166R, P176S, D177N, G196E, T200A, F214L, V245K, A272P, T286P, I293V, E297R  
>CA38259| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNSNIVI
IQYVDDLYVGSDLEIEQHRAKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGPKALTEVVPLTREAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009