<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES211 RES211 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, V82A, L90M   L10LI, I15V, K20R, E35D, M36I, N37ND, R41K, K43R, R57K, Q61N, I62V, L63A, A71V, I85V, Q92K  
>RES211| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTILEDIDLPGKWRPKMIGGIGGFIKVKQYD
NVAIEICGHKVIGTVLVGPTPANIVGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F A62V     V35IT, K122E, I135T, E169D, G196E, Q207E, F214L, V245E, E248N, A272P, K277R  
>RES211| codons 1-297
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELREHLLRWGLFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPNKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTE

References
Author Title Citation
Waleria-Aleixo, A Drug resistance mutation profile and accumulation kinetics in human immunodeficiency virus-positive individuals infected with subtypes B and F failing highly active antiretroviral therapy are influenced by different viral codon usage patterns. AAC, 2008