<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14442 CA38244 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   N37T, K43KR, L63P, I72V, V77I, I93L  
>CA38244| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMTLPGRWRPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62AV     K122KE, I135T, T200TA, Q207E, R211K, F214L, I329V, Y339D, T377Q, T386I, A400T, T403I, K431T, V435A, H483N, L484I, K527N, A554S  
>CA38245| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTDQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIAQESIVIWGKIPKFKLPIQKETWETWWIEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AINIALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLINKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009