<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES103 RES103 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, I54IV, V82VA, L90LM N88ND I3V, L10I, L19V, K20T, E35D, M36I, I62IV, L63P, I64IV  
>RES103| codons 1-99
PQVTLWQRPIVTIKIGGQVTEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFVKVRQYD
QVPVEICGHKAIGTVLVGPTPANIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, L210LW T215TS, K219Q L100LI, K103KN   K11KR, T39TA, T69TA, V118VI, K122E, I135IT, I142IV, E203ED, Q207QE, R211K, F214FL, L228LH, V245VL D17V, Q151K
>RES103| codons 1-256
PISPIETVPVRLKPGMVGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSARWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPKGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDELREHLWKWGLSTPDQKHQKEPPFHWMGYELHPDKWT
VQPILLPEKDSWTVND

References
Author Title Citation
Waleria-Aleixo, A Drug resistance mutation profile and accumulation kinetics in human immunodeficiency virus-positive individuals infected with subtypes B and F failing highly active antiretroviral therapy are influenced by different viral codon usage patterns. AAC, 2008