<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14311 CA38217 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 169
2 3TC+D4T+NVP 96
3 3TC+APV+D4T 130
4 3TC+APV+D4T+DDC 43
5 3TC+APV+D4T+DDC+RTV 22
6 3TC+APV+D4T+DDC 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R, M184V, T215F D67G, K219Q Y181C, G190A   E6D, S68G, K101Q, K102R, K122E, I135T, I142V, K173KR, Q207R, R211Q, D218E, L228H, R284K, I293V, E297V  
>CA38217| codons 1-300
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGGDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQRKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRQNPDIVI
CQYVDDLYVASDLEIGQHRTKIEELRRHLLQWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVPLTVEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54ILM, I84V, L90M G73T, L89V I13IV, L19Q, K20IM, L33LV, R57RK, I62V, L63P  
>CA38216| codons 1-99
PQITLWQRPLVTVKIGGQQMEALLDTGADDTVVEEMNLPGRWKPKIIGGIGGFMKVKQYD
QVPIEICGHKAITTVLVGPTPVNVIGRNVMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005