<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14297 CA38211 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 48
2 3TC+AZT 22
3 3TC+AZT+IDV 52
4 3TC+DDC+NFV 31
5 D4T+DDI+DLV 78
6 ABC+APV+D4T+DDI 186

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LI, L210W, T215Y       K20R, K32E, V35L, T39D, E40F, R83K, V90I, V118I, K122E, T139K, K173T, I178FL, G196E, Q207E, H208Y, R211RK, V245E, E297A  
>CA38211| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIEALLEICDFLEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPDLVI
YQYMDDLYVGSDLEIEQHRTKIEELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTAEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IL K43T L10I, I15V, E34K, E35ED, M36I, I62T, L63P, A71V, I93L K20E
>CA38210| codons 1-99
PQITLWQRPIVTIKVGGQLEEALLDTGADDTVLKDINLPGRWTPKMIGGIGGFLKVRQYD
QTPIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009