<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES80 RES80 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V G73T L10V, I13V, N37ND, I62V, L63P, I66F, H69R, I72L, V77I  
>RES80| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD
QVPIEFCGRKALTTVLIGPTPVNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y A62V K101EQ, Y181C, G190A A98G V8VI, K43E, E44D, K49R, I135T, I195L, G196E, L228R, V245T  
>RES80| codons 1-263
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEDGKISRIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLQKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLELEQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGK

References
Author Title Citation
Waleria-Aleixo, A Drug resistance mutation profile and accumulation kinetics in human immunodeficiency virus-positive individuals infected with subtypes B and F failing highly active antiretroviral therapy are influenced by different viral codon usage patterns. AAC, 2008