<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9986 CA38184 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 31
2 DDI 13
3 3TC+AZT+IDV 383
4 3TC+EFV+LPV+TDF 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A V11I, L24I, Q58E L10I, I15V, I62V, L63P, A71V, I72T  
>CA38184| codons 1-99
PQITLWQRPIITIKVGGQLKEALIDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVREYD
QVPIEICGHKVTGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219E     T39TA, S68G, D123E, I142IT, S162CY, D177E, I178L, G196K, R211G, V245E, A272P, K277R, E297A  
>CA38185| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPELVI
YQYVDDLYVGSDLEIKQHRTKIEELRQHLWGWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005