<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14714 CA38172 U.S. 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12S, K14R, I15V, L19I, K20T, E35D, M36I, R41K, K45R, L63PS, I64V, H69K, L89M, I93L  
>CA38172| codons 1-99
PQITLWQRPLVSIRVGGQITEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QISVEICGKKAIGTVLVGPTPVNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, E36A, T39D, S48T, V60I, D121DY, K122E, D123DG, I135R, S162A, K173A, T200A, I202IV, Q207AG, R211K, V245Q, A272P, V276I, K277R, T286A, T290TA, E291D, V292I, I293V  
>CA38173| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEGFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAQNPDIVI
YQYVDDLYVGSDLEIGQHRAKVEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIRQLCKLLRGAKALADIVPLTEEAE

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009