<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14602 CA38155 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 13
2 3TC+AZT+NFV 174
3 3TC+DDI+NFV+TDF 9
4 3TC+AZT+NFV 34

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       R83K, V90I, K122KE, I135M, S162Y, K173KE, G196GR, A272P, K275KR, K277R, E297Q, Y339YD, F346Y, V435E, L452S, D460N, V467I  
>CA38155| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFREQNPDIVI
YQYVDDLYVGSDLEIRQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTQEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTDQIYQEPYKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAANRETKSGKAGYVTNRGRQKVISLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88ND I13V, L19I, K20KR, E35D, M36I, R41K, L63P, K70R, A71AT P44PL
>CA38154| codons 1-99
PQITLWQRPLVTVKIGGQIREALLDTGADNTVLEDINLPGKWKLKMIGGIGGFIKVRQYD
QIPIEICGHRTIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009