<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1280 CA38144 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ RTV+ AZT 4
2 3TC+ AZT+ NFV 34
3 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19I, R41RK, L63P, A71T, I72IT, V77I, I93L  
>CA38144| codons 1-99
PQITLWQRPLVTVKIGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTTGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   K101P, K103N   K20KR, V35I, K104KR, I135R, V189I, V245E, R284K, T286A, P294T H235HQ, P236PT
>CA38145| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKNRSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYIGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELQTDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTEVITLTEEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005