<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA790 CA38141 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 365
2 AZT+DDC 22
3 3TC+AZT 31
4 3TC+AZT+IDV 9
5 3TC+D4T+IDV 60
6 D4T+DDI+RTV+SQV 58
7 D4T+DDI+EFV+RTV+SQV 28
8 D4T+DDI+EFV+SQV 18
9 Unknown 207

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, T215Y K219Q Y181YC, G190GRS   V35I, T39A, K49R, K70X, K101Q, V106VI, K122E, D123E, I135T, V179VI, D218E, D237E, E248D, I293V, E297A  
>CA38141| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISRIGPENPYNTPV
FAIKKKNSTXWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSITVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYMDDLYVSSDLEIGQHRTKIEELRQHLLRWGFYTPEQKHQKEPPFLWMGYELHPEKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, I84IV L10F, L24I, L33LF, G73S I13V, L19LI, L63P, I66V, I72MV, P79AD, I93L  
>CA38140| codons 1-99
PQITLWQRPFVTVKIGGQIKEALIDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVRQYD
QIPIEVCGHKAVSTVLVGDTPVNVIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012