<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1498 CA38126 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 61
2 AZT 44
3 3TC+AZT+SQV 82
4 3TC+AZT 6
5 3TC+AZT+IDV 42
6 D4T+NFV+NVP 38
7 3TC+DDI+SQV 145
8 3TC+LPV+SQV+TDF 30
9 3TC+APV+LPV+TDF 30
10 3TC+LPV+TDF 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, I84V, L90M V11I, L33LF, G73S, L89LV L10I, I13V, I15V, K20T, I62V, L63P, A71V, I72L, P79AS  
>CA38126| codons 1-99
PQITLWQRPIITVKVGGQLTEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGHKVLSTVLVGSTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, L210W, T215Y K219E Y181C K101KHNQ E6K, E28A, K122E, S162C, E169D, Q174QR, Q197E, E203EK, Q207E, R211K, L228H, A272P, K277R, T286A, A288S, E297T, E300D  
>CA38127| codons 1-300
PISPIKTVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKRNPDIVI
CQYVDDLYVGSDLEIGEHRTKIKELREHLWKWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKSLTEVIPLTTEAD

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005