<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5042 CA38122 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 3TC+AZT+IDV 144
3 ABC+D4T+RTV+SQV 21
4 None 18
5 ABC+D4T+EFV+RTV+SQV 26
6 None 31
7 3TC+ABC+D4T 18
8 3TC+AZT+DDI 47
9 DDI+EFV+TDF 54

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14KR, L19I, L63S, V77I  
>CA38122| codons 1-99
PQITLWQRPLVSIRIGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74IV T215I, K219E L100I, K103N   D123E, I135T, K166R, G196E, T200A, I202V, L228LR, K277R, L283I, A288T, I293V, P294I, E297P  
>CA38123| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKVEELRQHLLRWGFITPDEKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLIRGTKTLTEVVILTPEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005