<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3935 CA38111 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 38
2 D4T+RTV+SQV 31
3 3TC+D4T+IDV 174
4 3TC+D4T+NFV 96
5 APV+DLV+EFV+LPV+TDF 4
6 APV+DLV+EFV+TDF 53

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y K219Q Y181C, G190A K101N K20R, V21I, T39A, E44D, V60I, R83K, K103R, V118I, K122E, I135T, K173R, Q174K, N175Y, G196E, H208Y, R211K, D218E, A272P, I293V  
>CA38111| codons 1-300
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLMDFRELNKKTQDFWEVQLGIPHPAGLNKRKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKYPDIVI
CQYVDDLYVASDLEIEQHRTKIEELRQYLWKWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F, L90M G73S L10I, L63P, A71V, V77I, I93L  
>CA38110| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVISTVLIGPTPFNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009