<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7859 CA38104 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 83
2 3TC+AZT 35
3 3TC+AZT+NFV 96
4 D4T+IDV+NVP 17
5 ABC+APV+DDI 218

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46IL, I54M, I84V, L90M L33F L10I, I13V, K20T, L63P, A71V, T74S, V77I, L89M, I93L  
>CA38104| codons 1-99
PQITLWQRPIVTVKIGGQLTEALLDTGADDTVFEEMNLPGRWKPKLIGGIGGFMKVRQYD
QIPIEICGHKVIGSVLIGPTPVNVIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, Y115F, M184V, L210W, T215Y   Y188L   V35I, T69N, V118VI, D121C, K122E, I135V, S162C, V179I, T200I, I202V, A272P, K277R, L283I, A288T, I293V  
>CA38105| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFFSIPL
CEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
YQYVDDLLVGSDLEIGQHRIKVEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKTLTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005