<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1497 CA38096 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 152
2 AZT+ DDI 17
3 3TC+ AZT 17
4 AZT+ 3TC+ IDV 34
5 D4T+ DDI+ RTV 43
6 DDI+3TC+NVP+SQV+RTV+D4T 13
7 D4T+DDI+3TC+SQV+RTV 76
8 D4T+DDI+3TC+SQV 39
9 RTV+EFV+APV 23
10 APV+EFV+LPV 12
11 None 52
12 APV+EFV+SQV+TDF 26
13 APV+DDI+EFV+SQV+TDF 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M Q58E, G73T L10I, I13V, L19LQ, K20I, F53FY, K55KR, L63P, H69HR, A71V, I72IV  
>CA38096| codons 1-99
PQITLWQRPIVTVKIGGQQIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGYVRVREYD
QIPIEICGRKVVTTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   Y181C, G190A A98G, K101H, V108VI K20R, V35I, K43E, V118I, D123E, I135T, D177E, V189VI, T200K, Q207DE, H208Y, R211K, E248D, A272S, K277R, I293V  
>CA38097| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGLHKKKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYIASDLEIGQHRKKIEELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005