<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6602 CA38092 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 ABC+EFV 65
3 APV+LPV+TDF 86

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M L33F, K43T, G73A L10I, K20R, E35D, M36I, R57K, Q61E, I62V, L63P, I64V, I93L  
>CA38092| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVFEDINLPGRWTPKIIGGIGGFVKVKQYD
EVPVEICGHKAIATVLVGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y A62V K103N   K122E, I135T, E138Q, S162C, E169D, I178L, T200A, R211K  
>CA38093| codons 2-246
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVF
VIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLD
EDFRKYTAFTIPSTNNQTPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDLVIY
QYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005