<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Tx22 307 Korea 2011 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 3TC|ATV|AZT|EFV|IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I84V L33LF, F53L, L89V L10Y, T12V, I13V, G16E, K20M, E35D, M36I, N37ND, R41K, R57K, H69K, A71I, I72R  
>307| codons 1-99
PQITLWQRPYVVVKIEGQLMEALLDTGADDTIFEDIDLPGKWKPKIVGGIGGLIKVKQYD
QILIEICGKKIRGTVLVGPTPVNVIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       E6D, K11T, V35T, T39K, K43E, V60I, S68G, K122E, D123S, I135T, Q174K, D177E, I178M, T200A, Q207A, R211S, F214FL  
>307| codons 1-240
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGLYTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Kim, MH HIV antiretroviral resistance mutations among antiretroviral treatment-naive and -experienced patients in South Korea. ARHR, 2013