<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5177 CA38076 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 57
2 3TC+D4T+IDV 35
3 AZT+DDC+NFV 26
4 AZT+DDI+RTV+SQV 17
5 3TC+ABC+EFV 26
6 3TC+D4T+IDV+RTV 43
7 3TC+ABC+D4T+IDV+RTV 17
8 3TC+ABC+AZT+EFV 52
9 DDI+LPV+TDF 31
10 APV+DDI+LPV+TDF 82

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54V, V82A, L90M L33F, K43T, F53L, G73S Q7R, L10V, I15V, K20T, E35D, M36I, R57RK, I62V, L63P, I66F, H69HR, A71V, I72L  
>CA38076| codons 1-99
PQITLWRRPVVTIKVGGQLTEALLDTGADDTVFEDINLPGRWTPKMIMGIGGLVKVKQYD
QVPIEFCGRKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M A62V, V75I, F77L, F116Y     P4S, S68G, W88WS, V118I, K122E, V245I, E248D, V276T, Q278H, K281R, L283I, T286TA, I293V  
>CA38077| codons 1-300
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKRKDGTKWRKLIDLRELNKRTQDFSEVQLGIPHPAGLKKKKSVTVLDVGDAYYSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPDKDSWTVNDIQKLVGKLNWASQIYAGIKTKHLCRLIRGAKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009