<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1494 CA38070 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 22
2 DDI 6
3 3TC+AZT+IDV 8
4 3TC+D4T+RTV 45
5 3TC+D4T+NFV 12
6 3TC+D4T+RTV+SQV 19
7 3TC+DDI+NFV+RTV 23
8 D4T+RTV+SQV 27
9 EFV+RTV+SQV 6
10 3TC+APV+DDI+EFV+NFV 209

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, L90M   L10I, R57K, L63P, A71V, T74S, V77I, I93L  
>CA38070| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVKQYD
QIPIEICGHKVIGSVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184MI, T215F K219Q K101E, Y181YC, G190S   P4S, K20R, V60I, V90VI, K122E, D177E, I178M, Q207E, V245E, A272P, K277R, I293V, E297Q  
>CA38071| codons 1-300
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYIDDLYVSSDLEIGQHRTKIEELREHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTQEAE

References
Author Title Citation
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005