<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1113 CA38067 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 17
2 3TC+AZT+SQV 26
3 3TC+AZT+NVP 8
4 3TC+D4T+NFV 27
5 3TC+D4T+RTV+SQV 134
6 3TC+ABC+EFV 136
7 Unknown 14

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V   L100I, K103N   K11KR, K122E, I135T, I142V, K173KE, D177G, F214L, H221Y, V245T, I293V, E297K  
>CA38067| codons 1-300
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAFFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPGIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M Q58E, G73GS T12M, K20R, E35D, M36I, N37DE, R57K, I62V, L63P, A71V  
>CA38066| codons 1-99
PQITLWQRPLVMIKIGGQLREALLDTGADDTVLEDIELPGRWKPKMIGGIGGFIKVKEYD
QVPIEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005