<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7887 CA38052 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 69
2 D4T 52
3 3TC+AZT+D4T 83
4 D4T+NVP+RTV+SQV 8
5 D4T+RTV+SQV 31
6 D4T+DDI+NFV 57
7 D4T+DDI+RTV 22
8 D4T+RTV+SQV 170

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IL, I84V, L90M G73S L10I, L63P, I66IV, A71V, V77I  
>CA38052| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFLKVRQYD
QIPIEVCGHKVISTVLIGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y       E6D, R83K, R284RK, T286A, E297K  
>CA38053| codons 1-299
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTEVIPLTKEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005